General Information

  • ID:  hor000502
  • Uniprot ID:  A0A8J5MS43
  • Protein name:  Allatostatin B
  • Gene name:  AstB1-L
  • Organism:  Homarus americanus (American lobster)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  TNWNKFQGSW
  • Length:  10(77-86)
  • Propeptide:  MMTAQQMCRPWALLMVVLVAGATQVSSSSSSPQQDDPASSPSHIEEKRVGWSSMHGTWGKRPHLEDAQLDAAEVKRTNWNKFQGSWGKRGEELQAAEDKRTNWNKFQGSWGKRGDDLADAEL
  • Signal peptide:  MMTAQQMCRPWALLMVVLVAGATQVSS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000502_AF2.pdbhor000502_ESM.pdb

Physical Information

Mass: 142807 Formula: C59H78N16O16
Absent amino acids: ACDEHILMPRVY Common amino acids: NW
pI: 9.7 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -153 Boman Index: -2176
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 1962 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1222.22

Literature

  • PubMed ID:  22860213
  • Title:  Mass Spectral Charting of Neuropeptidomic Expression in the Stomatogastric Ganglion at Multiple Developmental Stages of the Lobster Homarus Americanus